PDB entry 4m8y

View 4m8y on RCSB PDB site
Description: GS-8374, a Novel Phosphonate-Containing Inhibitor of HIV-1 Protease, Effectively Inhibits HIV PR Mutants with Amino Acid Insertions
Class: Hydrolase/Hydrolase Inhibitor
Keywords: HIV-1 protease, aspartic protease, amino acid insertion, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2013-08-14, released 2014-05-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.201
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90JJ9 (0-99)
      • engineered mutation (9)
      • engineered mutation (12)
      • engineered mutation (15)
      • engineered mutation (19)
      • insertion (33)
      • engineered mutation (37)
      • engineered mutation (46)
      • engineered mutation (54)
      • engineered mutation (71)
    Domains in SCOPe 2.08: d4m8ya_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90JJ9 (0-99)
      • engineered mutation (9)
      • engineered mutation (12)
      • engineered mutation (15)
      • engineered mutation (19)
      • insertion (33)
      • engineered mutation (37)
      • engineered mutation (46)
      • engineered mutation (54)
      • engineered mutation (71)
    Domains in SCOPe 2.08: d4m8yb_
  • Heterogens: KGQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4m8yA (A:)
pqitlwqrpfvtvkiagqlmealldtgaddtileeemslpgrwtpkvvggiggfmkvrqy
dqilveicghkvigtvlvgptpaniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4m8yB (B:)
pqitlwqrpfvtvkiagqlmealldtgaddtileeemslpgrwtpkvvggiggfmkvrqy
dqilveicghkvigtvlvgptpaniigrnlltqigctlnf