PDB entry 4m8u

View 4m8u on RCSB PDB site
Description: The Structure of MalL mutant enzyme V200A from Bacillus subtilus
Class: hydrolase
Keywords: TIM barrel, alpha glucosidase, HYDROLASE
Deposited on 2013-08-13, released 2013-09-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.139
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oligo-1,6-glucosidase 1
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: BSU34560, malL, yvdL
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06994 (Start-559)
      • engineered mutation (199)
    Domains in SCOPe 2.03: d4m8ua1, d4m8ua2
  • Heterogens: TRS, GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m8uA (A:)
    msewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddn
    gydisdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnp
    yrdyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrre
    vydvmrfwmdrgvdgwrmdaigsiskytdfpdyetdhsrsyivgryhsngprlhefiqem
    nrevlshydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqik
    pfdlialkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhg
    mkgtpfiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdh
    artpmqwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykim
    iygdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnype
    radlksislkpyeavmgisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m8uA (A:)
    sewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddng
    ydisdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnpy
    rdyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrrev
    ydvmrfwmdrgvdgwrmdaigsiskytdfpdyetdhsrsyivgryhsngprlhefiqemn
    revlshydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqikp
    fdlialkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhgm
    kgtpfiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdha
    rtpmqwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykimi
    ygdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnyper
    adlksislkpyeavmgisi