PDB entry 4m8i

View 4m8i on RCSB PDB site
Description: 1.43 Angstrom resolution crystal structure of cell division protein FtsZ (ftsZ) from Staphylococcus epidermidis RP62A in complex with GDP
Class: cell cycle
Keywords: Center for Structural Genomics of Infectious Diseases, CSGID, NIAID, National Institute of Allergy and Infectious Diseases, CELL CYCLE
Deposited on 2013-08-13, released 2013-09-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.171
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Staphylococcus epidermidis [TaxId:176279]
    Gene: ftsZ, SERP0751
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4m8ia1, d4m8ia2
  • Heterogens: GDP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m8iA (A:)
    mhhhhhhlefeqgfnhlatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlsk
    aeskiqigekltrglgaganpeigkkaaeesreqiedaiqgadmvfvtagmgggtgtgaa
    pvvakiakemgaltvgvvtrpfgfegrkrqtqaaagvesmkaavdtlivipndrlldivd
    kstpmmeafkeadnvlrqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssge
    nraveaakkaissplletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmif
    gtvinpelqdeivvtviatgfedkpssqgrkatstgfgssvnsssnhqsgasakedsfsa
    htshsqssesvsershttkdddipsfirnreerrsrrtrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m8iA (A:)
    latlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglg
    aganpeigkkaaeesreqiedaiqgadmvfvtagmgggtgtgaapvvakiakemgaltvg
    vvtrpfgfegrkrqtqaaagvesmkaavdtlivipndrlldivdkstpmmeafkeadnvl
    rqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaisspll
    etsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtv
    iatgfedkpss