PDB entry 4m87

View 4m87 on RCSB PDB site
Description: Crystal Structure of Enoyl-Acyl Carrier Protein Reductase (FabI) from Neisseria meningitidis in complex with NAD+
Class: oxidoreductase
Keywords: Enoyl, acyl carrier protein, ACP, Neisseria, Rossmann Fold, Reductase, NAD, OXIDOREDUCTASE
Deposited on 2013-08-13, released 2013-10-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.17
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Neisseria meningitidis [TaxId:272831]
    Gene: fabI, NMC1834
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4m87a_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Neisseria meningitidis [TaxId:272831]
    Gene: fabI, NMC1834
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4m87b_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m87A (A:)
    mgflqgkkilitgmisersiaygiakacreqgaelaftyvvdkleervrkmaaeldselv
    frcdvasddeinqvfadlgkhwdgldglvhsigfapkealsgdfldsisreafntaheis
    ayslpalakaarpmmrgrnsaivalsylgavraipnynvmgmakasleagirftaaclgk
    egircngisagpiktlaasgiadfgkllghvaahnplrrnvtieevgntaafllsdlssg
    itgeityvdggysinalsteg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m87A (A:)
    gflqgkkilitgmisersiaygiakacreqgaelaftyvvdkleervrkmaaeldselvf
    rcdvasddeinqvfadlgkhwdgldglvhsigfapkealsgdfldsisreafntaheisa
    yslpalakaarpmmrgrnsaivalsylgavraipnynvmgmakasleagirftaaclgke
    gircngisagpiktlaasgiadfgkllghvaahnplrrnvtieevgntaafllsdlssgi
    tgeityvdggysinals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m87B (B:)
    mgflqgkkilitgmisersiaygiakacreqgaelaftyvvdkleervrkmaaeldselv
    frcdvasddeinqvfadlgkhwdgldglvhsigfapkealsgdfldsisreafntaheis
    ayslpalakaarpmmrgrnsaivalsylgavraipnynvmgmakasleagirftaaclgk
    egircngisagpiktlaasgiadfgkllghvaahnplrrnvtieevgntaafllsdlssg
    itgeityvdggysinalsteg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m87B (B:)
    gflqgkkilitgmisersiaygiakacreqgaelaftyvvdkleervrkmaaeldselvf
    rcdvasddeinqvfadlgkhwdgldglvhsigfapkealsgdfldsisreafntaheisa
    yslpalakaarpmmrgrnsaivalsylgavraipnynvmgmakasleagirftaaclgke
    gircngisagpigkllghvaahnplrrnvtieevgntaafllsdlssgitgeityvdggy
    sinals