PDB entry 4m7y

View 4m7y on RCSB PDB site
Description: Staphylococcus aureus Type II pantothenate kinase in complex with a pantothenate analog
Class: transferase/transferase inhibitor
Keywords: pantothenate kinase, inhibitor, antibacterial, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-08-12, released 2014-09-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:196620]
    Gene: coaW, MW2054
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m7ya_
  • Chain 'B':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:196620]
    Gene: coaW, MW2054
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m7yb_
  • Heterogens: 2GH, ADP, PO4, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m7yA (A:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalylekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m7yA (A:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalyle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m7yB (B:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalylekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m7yB (B:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalyle