PDB entry 4m7x

View 4m7x on RCSB PDB site
Description: Staphylococcus aureus Type II pantothenate kinase in complex with a pantothenate analog
Class: TRANSFERASE/TRANSFERASE inhibitor
Keywords: pantothenate kinase, inhibitor, antibacterial, TRANSFERASE-TRANSFERASE inhibitor complex
Deposited on 2013-08-12, released 2014-09-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.172
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:196620]
    Gene: coaW, MW2054
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NVG0 (0-266)
      • expression tag (267-272)
    Domains in SCOPe 2.06: d4m7xa1, d4m7xa2
  • Heterogens: ADP, MG, UNX, 27Q, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m7xA (A:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalylekhhhhhh