PDB entry 4m77

View 4m77 on RCSB PDB site
Description: Crystal structure of Lsm2-8 complex, space group I212121
Class: structural protein
Keywords: Sm Like protein, RNA splicing, STRUCTURAL PROTEIN
Deposited on 2013-08-12, released 2013-11-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 3.11 Å
R-factor: 0.248
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U6 snRNA-associated Sm-like protein LSm8
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM8, YJR022W, J1464, YJR83.16
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47093
      • engineered mutation (16)
      • engineered mutation (21)
      • engineered mutation (37)
      • engineered mutation (50)
  • Chain 'B':
    Compound: u6 snrna-associated sm-like protein lsm2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM2, SMX5, SNP3, YBL026W, YBL0425
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38203 (0-End)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d4m77b_
  • Chain 'C':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM3, SMX4, USS2, YLR438C-A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57743
      • engineered mutation (36)
      • engineered mutation (62)
    Domains in SCOPe 2.06: d4m77c_
  • Chain 'D':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM6, YDR378C, D9481.18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m77d_
  • Chain 'E':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM5, YER146W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m77e_
  • Chain 'F':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM7, YNL147W, N1202, N1780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m77f_
  • Chain 'G':
    Compound: u6 snrna-associated sm-like protein lsm4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM4, SDB23, USS1, YER112W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m77g_
  • Chain 'H':
    Compound: U6 snRNA-associated Sm-like protein LSm8
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM8, YJR022W, J1464, YJR83.16
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47093
      • engineered mutation (16)
      • engineered mutation (21)
      • engineered mutation (37)
      • engineered mutation (50)
  • Chain 'I':
    Compound: u6 snrna-associated sm-like protein lsm2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM2, SMX5, SNP3, YBL026W, YBL0425
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38203 (0-End)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d4m77i_
  • Chain 'J':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM3, SMX4, USS2, YLR438C-A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57743
      • engineered mutation (36)
      • engineered mutation (62)
    Domains in SCOPe 2.06: d4m77j_
  • Chain 'K':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM6, YDR378C, D9481.18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m77k_
  • Chain 'L':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM5, YER146W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m77l_
  • Chain 'M':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM7, YNL147W, N1202, N1780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m77m_
  • Chain 'N':
    Compound: u6 snrna-associated sm-like protein lsm4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM4, SDB23, USS1, YER112W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m77n_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m77B (B:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni
    firgstvryvylnknmvdtnllqdatrrevmterk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m77B (B:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni
    firgstvryvylnknmvdtnllqdatrrevm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4m77C (C:)
    metpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlnneelsese
    rrsemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m77C (C:)
    tpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyeserrsemvfirg
    dtvtlistp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4m77D (D:)
    msgkastegsvtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnn
    nkllnkfnsdvflrgtqvmyiseqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m77D (D:)
    svtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnnnkllnkfns
    dvflrgtqvmyiseq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4m77E (E:)
    mslpeilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidpedesr
    nekvmqhhgrmllsgnniailvpggkktpteal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m77E (E:)
    ilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlkvmqhhgrmllsg
    nniailvpgg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4m77F (F:)
    mhqqhsksenkpqqqrkkfegpkreaildlakykdskirvklmggklvigvlkgydqlmn
    lvlddtveymsnpddenntelisknarklgltvirgtilvslssaegsdvlymqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m77F (F:)
    ildlakykdskirvklmggklvigvlkgydqlmnlvlddtveymnarklgltvirgtilv
    slssa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4m77G (G:)
    mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteyseesainsednaes
    skavklneiyirgtfikfiklqdniidkvkqqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m77G (G:)
    mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteysvklneiyirgtfi
    kfiklqdnii
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4m77I (I:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni
    firgstvryvylnknmvdtnllqdatrrevmterk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m77I (I:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni
    firgstvryvylnknmvdtnllqdatrrevm
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4m77J (J:)
    metpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlnneelsese
    rrsemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m77J (J:)
    tpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlneserrsemvf
    irgdtvtlistp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4m77K (K:)
    msgkastegsvtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnn
    nkllnkfnsdvflrgtqvmyiseqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m77K (K:)
    svtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnnnkllnkfns
    dvflrgtqvmyiseq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4m77L (L:)
    mslpeilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidpedesr
    nekvmqhhgrmllsgnniailvpggkktpteal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m77L (L:)
    ilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidnekvmqhhgrm
    llsgnniailvpg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4m77M (M:)
    mhqqhsksenkpqqqrkkfegpkreaildlakykdskirvklmggklvigvlkgydqlmn
    lvlddtveymsnpddenntelisknarklgltvirgtilvslssaegsdvlymqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m77M (M:)
    ildlakykdskirvklmggklvigvlkgydqlmnlvlddtveymnarklgltvirgtilv
    slssa
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4m77N (N:)
    mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteyseesainsednaes
    skavklneiyirgtfikfiklqdniidkvkqqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m77N (N:)
    mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteysvklneiyirgtfi
    kfiklqdnii