PDB entry 4m76

View 4m76 on RCSB PDB site
Description: Integrin I domain of complement receptor 3 in complex with C3d
Class: cell adhesion
Keywords: integrin, complement receptor, immunity, innate immunity, inflammation, phagocytosis, Mac-1, CD11b/CD18, alphaMbeta2, macrophage, Rossmann fold, I domain, Von Willebrand Factor A (VWA), alpha-alpha barrel, adhesion, cell adhesion
Deposited on 2013-08-12, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C3
    Species: Homo sapiens [TaxId:9606]
    Gene: C3, CPAMD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01024 (3-End)
      • expression tag (1-2)
      • engineered mutation (19)
    Domains in SCOPe 2.07: d4m76a1, d4m76a2
  • Chain 'B':
    Compound: Integrin alpha-M
    Species: Homo sapiens [TaxId:9606]
    Gene: CD11B, CR3A, ITGAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m76b_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m76A (A:)
    gamavdaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelik
    kgytqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlile
    kqkpdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsit
    kagdfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynv
    eatsyallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m76A (A:)
    amavdaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikk
    gytqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilek
    qkpdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitk
    agdfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynve
    atsyallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m76B (B:)
    gamgspqedsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrih
    ftfkefqnnpnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdg
    ekfgdplgyedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfe
    alktiqnqlrekgfaieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m76B (B:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqn