PDB entry 4m5s

View 4m5s on RCSB PDB site
Description: Human alphaB crystallin core domain in complex with C-terminal peptide
Deposited on 2013-08-08, released 2014-04-09
The last revision was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.158
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-crystallin b chain
    Species: Homo sapiens [TaxId:9606]
    Gene: CRYA2, CRYAB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02511 (1-86)
      • expression tag (0)
  • Chain 'B':
    Compound: alpha-crystallin b chain
    Species: Homo sapiens [TaxId:9606]
    Gene: CRYA2, CRYAB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02511 (1-9)
      • expression tag (0)
  • Heterogens: SIN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4m5sA (A:)
gmrlekdrfsvnldvkhfspeelkvkvlgdvievhgkheerqdehgfisrefhrkyripa
dvdpltitsslssdgvltvngprkqvs

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >4m5sB (B:)
gertipitre