PDB entry 4m55

View 4m55 on RCSB PDB site
Description: Crystal structure of Human UDP-xylose synthase R236H substitution
Class: lyase
Keywords: short-chain dehydrogenase/reductase, decarboxylase, lyase, membrane, rossmann fold
Deposited on 2013-08-08, released 2013-08-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.231
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-glucuronic acid decarboxylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UNQ2538/PRO6079, UXS, UXS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NBZ7
      • engineered mutation (151)
    Domains in SCOPe 2.05: d4m55a_
  • Chain 'B':
    Compound: UDP-glucuronic acid decarboxylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UNQ2538/PRO6079, UXS, UXS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NBZ7
      • engineered mutation (151)
    Domains in SCOPe 2.05: d4m55b_
  • Chain 'C':
    Compound: UDP-glucuronic acid decarboxylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UNQ2538/PRO6079, UXS, UXS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NBZ7
      • engineered mutation (151)
    Domains in SCOPe 2.05: d4m55c_
  • Chain 'D':
    Compound: UDP-glucuronic acid decarboxylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UNQ2538/PRO6079, UXS, UXS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NBZ7
      • engineered mutation (151)
    Domains in SCOPe 2.05: d4m55d_
  • Chain 'E':
    Compound: UDP-glucuronic acid decarboxylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UNQ2538/PRO6079, UXS, UXS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4m55e_
  • Chain 'F':
    Compound: UDP-glucuronic acid decarboxylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UNQ2538/PRO6079, UXS, UXS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4m55f_
  • Heterogens: NAD, POP, SO4, UDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m55A (A:)
    ekdrkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhd
    vveplyievdqiyhlaspasppnymynpiktlktntigtlnmlglakrvgarlllastse
    vygdpevhpqsedywghvnpigpracydegkhvaetmcyaymkqegvevrvarifntfgp
    rmhmndgrvvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlg
    npeehtilefaqliknlvgsgseiqflseaqddpqkrkpdikkaklmlgwepvvpleegl
    nkaihyfrkeleyqannqyipkpkparikkgrtrhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m55A (A:)
    rkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvve
    plyievdqiyhlaspynpiktlktntigtlnmlglakrvgarlllastsevygkhvaetm
    cyaymkqegvevrvarifntfgprmhmndgrvvsnfilqalqgepltvqtrafqyvsdlv
    nglvalmnsnvsspvnlgnpeehtilefaqliknlvgsgseiqfrkpdikkaklmlgwep
    vvpleeglnkaihyfrkeleyqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m55B (B:)
    ekdrkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhd
    vveplyievdqiyhlaspasppnymynpiktlktntigtlnmlglakrvgarlllastse
    vygdpevhpqsedywghvnpigpracydegkhvaetmcyaymkqegvevrvarifntfgp
    rmhmndgrvvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlg
    npeehtilefaqliknlvgsgseiqflseaqddpqkrkpdikkaklmlgwepvvpleegl
    nkaihyfrkeleyqannqyipkpkparikkgrtrhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m55B (B:)
    rkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvve
    plyievdqiyhlaspaspynpiktlktntigtlnmlglakrvgarlllastsevyegkhv
    aetmcyaymkqegvevrvarifntfgprmhmndgrvvsnfilqalqgepltvygsgsqtr
    afqyvsdlvnglvalmnsnvsspvnlgnpeehtilefaqliknlvgsgseiqfrkpdikk
    aklmlgwepvvpleeglnkaihyfrkeleyqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4m55C (C:)
    ekdrkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhd
    vveplyievdqiyhlaspasppnymynpiktlktntigtlnmlglakrvgarlllastse
    vygdpevhpqsedywghvnpigpracydegkhvaetmcyaymkqegvevrvarifntfgp
    rmhmndgrvvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlg
    npeehtilefaqliknlvgsgseiqflseaqddpqkrkpdikkaklmlgwepvvpleegl
    nkaihyfrkeleyqannqyipkpkparikkgrtrhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m55C (C:)
    rkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvve
    plyievdqiyhlaspasynpiktlktntigtlnmlglakrvgarlllastsevyegkhva
    etmcyaymkqegvevrvarifntfgprmhmndgrvvsnfilqalqgepltvygsgsqtra
    fqyvsdlvnglvalmnsnvsspvnlgnpeehtilefaqliknlvgsgseiqflkpdikka
    klmlgwepvvpleeglnkaihyfrkeleyqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4m55D (D:)
    ekdrkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhd
    vveplyievdqiyhlaspasppnymynpiktlktntigtlnmlglakrvgarlllastse
    vygdpevhpqsedywghvnpigpracydegkhvaetmcyaymkqegvevrvarifntfgp
    rmhmndgrvvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlg
    npeehtilefaqliknlvgsgseiqflseaqddpqkrkpdikkaklmlgwepvvpleegl
    nkaihyfrkeleyqannqyipkpkparikkgrtrhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m55D (D:)
    rkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvve
    plyievdqiyhlasynpiktlktntigtlnmlglakrvgarlllastsevygkhvaetmc
    yaymkqegvevrvarifntfgprmhmndgrvvsnfilqalqgepltvysqtrafqyvsdl
    vnglvalmnsnvsspvnlgnpeehtilefaqliknlvgsgseiqflrkpdikkaklmlgw
    epvvpleeglnkaihyfrkel
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4m55E (E:)
    ekdrkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhd
    vveplyievdqiyhlaspasppnymynpiktlktntigtlnmlglakrvgarlllastse
    vygdpevhpqsedywghvnpigpracydegkhvaetmcyaymkqegvevrvarifntfgp
    rmhmndgrvvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlg
    npeehtilefaqliknlvgsgseiqflseaqddpqkrkpdikkaklmlgwepvvpleegl
    nkaihyfrkeleyqannqyipkpkparikkgrtrhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m55E (E:)
    rilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvvepl
    yievdqiyhlaspnpiktlktntigtlnmlglakrvgarlllastsvaetmcyaymkqeg
    vevrvarifntfqyvsdlvnglvalmnsnvsspvnldikkaklm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4m55F (F:)
    ekdrkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhd
    vveplyievdqiyhlaspasppnymynpiktlktntigtlnmlglakrvgarlllastse
    vygdpevhpqsedywghvnpigpracydegkhvaetmcyaymkqegvevrvarifntfgp
    rmhmndgrvvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlg
    npeehtilefaqliknlvgsgseiqflseaqddpqkrkpdikkaklmlgwepvvpleegl
    nkaihyfrkeleyqannqyipkpkparikkgrtrhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m55F (F:)
    ggagfvgshltdklmvdnfftgrkrnvehwiinhdvveplyievdqynpiktlktntigt
    lnmlglakrvgvaetmcyaymkqegvetfgprmhmndgrvvsnfilqalqvsdlvnglva
    lmnsnvsspvnltilefaqliknlvdikkaklmlgwepvvpleeglnkaihyfrkeleyq
    a