PDB entry 4m4y

View 4m4y on RCSB PDB site
Description: Crystal structure of a 2009 H1N1 influenza virus hemagglutinin with a stabilization mutation HA2 E47G
Class: viral protein
Keywords: viral envelope protein, viral fusion protein, stabilization mutant, VIRAL PROTEIN
Deposited on 2013-08-07, released 2013-09-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 subunit
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.03: d4m4ya_
  • Chain 'B':
    Compound: Hemagglutinin HA2 subunit
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (0-173)
      • engineered mutation (46)
      • expression tag (174)
  • Chain 'C':
    Compound: Hemagglutinin HA1 subunit
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.03: d4m4yc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 subunit
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (0-End)
      • engineered mutation (46)
  • Chain 'E':
    Compound: Hemagglutinin HA1 subunit
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.03: d4m4ye_
  • Chain 'F':
    Compound: Hemagglutinin HA2 subunit
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (0-End)
      • engineered mutation (46)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m4yA (A:)
    adpgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcn
    iagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfei
    fpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvl
    wgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvep
    gdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnih
    pitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m4yA (A:)
    gdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniag
    wilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpk
    tsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgi
    hhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdk
    itfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpit
    igkcpkyvkstklrlatglrnips
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4m4yC (C:)
    adpgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcn
    iagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfei
    fpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvl
    wgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvep
    gdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnih
    pitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m4yC (C:)
    gdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniag
    wilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpk
    tsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgi
    hhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdk
    itfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpit
    igkcpkyvkstklrlatglrnip
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4m4yE (E:)
    adpgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcn
    iagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfei
    fpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvl
    wgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvep
    gdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnih
    pitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m4yE (E:)
    dpgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcni
    agwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeif
    pktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlw
    gihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepg
    dkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihp
    itigkcpkyvkstklrlatglrnips
    

  • Chain 'F':
    No sequence available.