PDB entry 4m4s

View 4m4s on RCSB PDB site
Description: Gamma subunit of the translation initiation factor 2 from Sulfolobus solfataricus in complex with GDP and formate ion mimic aIF2gamma*GDP*Pi complex (a formate ion substitutes for Pi)
Class: translation
Keywords: aIF2, aIF2 gamma subunit, G-protein, translation, translation initiation, protein biosynthesis, RNA-binding, GTP-binding, nucleotide-binding
Deposited on 2013-08-07, released 2014-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.153
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 subunit gamma
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Gene: eif2g
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q980A5 (Start-414)
      • engineered mutation (220)
      • engineered mutation (224)
      • engineered mutation (279)
    Domains in SCOPe 2.07: d4m4sa1, d4m4sa2, d4m4sa3
  • Heterogens: FMT, GDP, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m4sA (A:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsadvnapgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissiafgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m4sA (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsadvnapgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissiafgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei