PDB entry 4m4j

View 4m4j on RCSB PDB site
Description: radiation damage study of cu t6-insulin - 0.30 mgy
Deposited on 2013-08-07, released 2014-01-15
The last revision was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: insulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: insulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: insulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CU, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4m4jA (A:)
giveqccasvcslyqlenycn

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4m4jB (B:)
fvnqhlcgshlvealylvcgergffytpka

    Sequence, based on observed residues (ATOM records):
    >4m4jB (B:)
vnqhlcgshlvealylvcgergffytpk

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >4m4jC (C:)
giveqccasvcslyqlenycn

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >4m4jD (D:)
fvnqhlcgshlvealylvcgergffytpka