PDB entry 4m44

View 4m44 on RCSB PDB site
Description: Crystal structure of hemagglutinin of influenza virus B/Yamanashi/166/1998 in complex with avian-like receptor LSTa
Class: viral protein
Keywords: receptor binding, fusion, sialic acid, VIRAL PROTEIN
Deposited on 2013-08-06, released 2013-09-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.187
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza B virus [TaxId:416659]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4m44a_
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza B virus [TaxId:416659]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: hemagglutinin HA1
    Species: Influenza B virus [TaxId:416659]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4m44c_
  • Chain 'D':
    Compound: hemagglutinin HA2
    Species: Influenza B virus [TaxId:416659]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: hemagglutinin HA1
    Species: Influenza B virus [TaxId:416659]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4m44e_
  • Chain 'F':
    Compound: hemagglutinin HA2
    Species: Influenza B virus [TaxId:416659]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m44A (A:)
    drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtktrgklcptclnc
    tdldvalgrpmcvgvtpsakasilhevrpvtsgcfpimhdrtkirqlpnllrgyekirls
    tqnvinaekapggpyrlgtsgscpnatsrsgffatmawavpkdnnktatnpltvevphic
    tkeedqitvwgfhsddktqmknlygdsnpqkftssangvtthyvsqiggfpdqtedgglp
    qsgrivvdymvqkpgktgtivyqrgillpqkvwcasgrskvikgslpligeadclhekyg
    glnkskpyytgehakaigncpiwvktplklangtkyrppakllker
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m44A (A:)
    drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtktrgklcptclnc
    tdldvalgrpmcvgvtpsakasilhevrpvtsgcfpimhdrtkirqlpnllrgyekirls
    tqnvinaekapggpyrlgtsgscpnatsrsgffatmawavpkdnnktatnpltvevphic
    tkeedqitvwgfhsddktqmknlygdsnpqkftssangvtthyvsqiggfpdqtedgglp
    qsgrivvdymvqkpgktgtivyqrgillpqkvwcasgrskvikgslpligeadclhekyg
    glnkskpyytgehakaigncpiwvktplklangtkyrppakll
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4m44C (C:)
    drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtktrgklcptclnc
    tdldvalgrpmcvgvtpsakasilhevrpvtsgcfpimhdrtkirqlpnllrgyekirls
    tqnvinaekapggpyrlgtsgscpnatsrsgffatmawavpkdnnktatnpltvevphic
    tkeedqitvwgfhsddktqmknlygdsnpqkftssangvtthyvsqiggfpdqtedgglp
    qsgrivvdymvqkpgktgtivyqrgillpqkvwcasgrskvikgslpligeadclhekyg
    glnkskpyytgehakaigncpiwvktplklangtkyrppakllker
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m44C (C:)
    drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtktrgklcptclnc
    tdldvalgrpmcvgvtpsakasilhevrpvtsgcfpimhdrtkirqlpnllrgyekirls
    tqnvinaekapggpyrlgtsgscpnatsrsgffatmawavpkdnnktatnpltvevphic
    tkeedqitvwgfhsddktqmknlygdsnpqkftssangvtthyvsqiggfpdqtedgglp
    qsgrivvdymvqkpgktgtivyqrgillpqkvwcasgrskvikgslpligeadclhekyg
    glnkskpyytgehakaigncpiwvktplklangtkyrppakll
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4m44E (E:)
    drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtktrgklcptclnc
    tdldvalgrpmcvgvtpsakasilhevrpvtsgcfpimhdrtkirqlpnllrgyekirls
    tqnvinaekapggpyrlgtsgscpnatsrsgffatmawavpkdnnktatnpltvevphic
    tkeedqitvwgfhsddktqmknlygdsnpqkftssangvtthyvsqiggfpdqtedgglp
    qsgrivvdymvqkpgktgtivyqrgillpqkvwcasgrskvikgslpligeadclhekyg
    glnkskpyytgehakaigncpiwvktplklangtkyrppakllker
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m44E (E:)
    drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtktrgklcptclnc
    tdldvalgrpmcvgvtpsakasilhevrpvtsgcfpimhdrtkirqlpnllrgyekirls
    tqnvinaekapggpyrlgtsgscpnatsrsgffatmawavpkdnnktatnpltvevphic
    tkeedqitvwgfhsddktqmknlygdsnpqkftssangvtthyvsqiggfpdqtedgglp
    qsgrivvdymvqkpgktgtivyqrgillpqkvwcasgrskvikgslpligeadclhekyg
    glnkskpyytgehakaigncpiwvktplklangtkyrppakll
    

  • Chain 'F':
    No sequence available.