PDB entry 4m3m

View 4m3m on RCSB PDB site
Description: Influenza Neuraminidase in complex with a stereomutated analogue of Oseltamivir carboxylate
Class: hydrolase/hydrolase inhibitor
Keywords: Sialidase, hydrolase-hydrolase inhibitor complex
Deposited on 2013-08-06, released 2014-02-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.177
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:385580]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4m3ma_
  • Heterogens: 22N, CA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m3mA (A:)
    gtymnnteaicdvkgfapfskdngirigsrghifvirepfvscspiecrtffltqgslln
    dkhsngtvkdrspfrtlmsvkvgqspnvyqarfeavawsatachdgkkwmtvgvtgpdsk
    avavihyggvptdvinswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqg
    riigqadisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagi
    psdtprgedaqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikng
    wtqtskeqvrkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwts
    sssivmcgvdyeiadwswhdgailpfdidk