PDB entry 4m3l

View 4m3l on RCSB PDB site
Description: crystal structure of the coiled coil domain of murf1
Deposited on 2013-08-06, released 2014-03-26
The last revision was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase TRIM63
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF, MURF1, RNF28, SMRZ, TRIM63
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969Q1 (Start-59)
      • expression tag (0-2)
      • variant (26)
      • variant (25)
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase TRIM63
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF, MURF1, RNF28, SMRZ, TRIM63
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969Q1
      • expression tag (0-2)
      • variant (26)
      • variant (25)
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase TRIM63
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF, MURF1, RNF28, SMRZ, TRIM63
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969Q1
      • expression tag (1-2)
      • variant (26)
      • variant (25)
  • Chain 'D':
    Compound: E3 ubiquitin-protein ligase TRIM63
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF, MURF1, RNF28, SMRZ, TRIM63
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969Q1
      • variant (27)
      • variant (26)
  • Heterogens: MPD, GOL, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4m3lA (A:)
gamdtlyaildekksellqritqeqeeklsfiealiqqyqeqldkstklvetaiqsldep
g

    Sequence, based on observed residues (ATOM records):
    >4m3lA (A:)
gamdtlyaildekksellqritqeqeeklsfiealiqqyqeqldkstklvetaiqsldep

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4m3lB (B:)
gamdtlyaildekksellqritqeqeeklsfiealiqqyqeqldkstklvetaiqsldep
g

    Sequence, based on observed residues (ATOM records):
    >4m3lB (B:)
gamdtlyaildekksellqritqeqeeklsfiealiqqyqeqldkstklvetaiqsld

  • Chain 'C':
    Sequence, based on SEQRES records:
    >4m3lC (C:)
gamdtlyaildekksellqritqeqeeklsfiealiqqyqeqldkstklvetaiqsldep
g

    Sequence, based on observed residues (ATOM records):
    >4m3lC (C:)
amdtlyaildekksellqritqeqeeklsfiealiqqyqeqldkstklvetaiqsld

  • Chain 'D':
    Sequence, based on SEQRES records:
    >4m3lD (D:)
gamdtlyaildekksellqritqeqeeklsfiealiqqyqeqldkstklvetaiqsldep
g

    Sequence, based on observed residues (ATOM records):
    >4m3lD (D:)
tlyaildekksellqritqeqeeklsfiealiqqyqeqldkstklvetaiqsl