PDB entry 4m2w

View 4m2w on RCSB PDB site
Description: Genetically engineered Carbonic Anhydrase IX in complex with Dorzolamide
Class: Lyase/Lyase Inhibitor
Keywords: Carbonic Anhydrase IX mimic, Lyase-Lyase Inhibitor complex
Deposited on 2013-08-05, released 2013-11-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.131
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (0-256)
      • engineered mutation (61)
      • engineered mutation (63)
      • engineered mutation (65)
      • engineered mutation (87)
      • engineered mutation (126)
      • engineered mutation (165)
      • engineered mutation (199)
    Domains in SCOPe 2.03: d4m2wa_
  • Heterogens: ZN, ETS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4m2wA (A:)
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
lpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk