PDB entry 4m2v

View 4m2v on RCSB PDB site
Description: Genetically engineered Carbonic Anhydrase IX in complex with Brinzolamide
Class: Lyase/Lyase Inhibitor
Keywords: Carbonic Anhydrase IX mimic, Lyase-Lyase Inhibitor complex
Deposited on 2013-08-05, released 2013-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Carbonic anhydrase 2
  Species: Homo sapiens [TaxId:9606]
  Gene: CA2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00918 (0-256)
    • engineered mutation (5)
    • engineered mutation (61)
    • engineered mutation (63)
    • engineered mutation (65)
    • engineered mutation (87)
    • engineered mutation (126)
    • engineered mutation (165)
    • engineered mutation (199)
  Domains in SCOPe 2.08: d4m2va_
• Heterogens: ZN, BZ1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4m2vA (A:)
  hwgygahngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
  hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
  ntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
  lpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
  wrpaqplknrqikasfk