PDB entry 4m2p

View 4m2p on RCSB PDB site
Description: Crystal structure of a non-myristoylated C39D recoverin mutant with one calcium ion bound to EF-hand 3
Class: metal binding protein
Keywords: calcium binding protein, ef hand, neuronal calcium sensing (ncs) family protein, inhibits rhodopsin kinase, rhodopsin kinase, retina, metal binding protein
Deposited on 2013-08-05, released 2013-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.205
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Recoverin
    Species: Bos taurus [TaxId:9913]
    Gene: RCV1, RCVRN, Recoverin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21457
      • engineered mutation (37)
    Domains in SCOPe 2.07: d4m2pa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m2pA (A:)
    gnsksgalskeileelqlntkfteeelsswyqsflkedpsgritrqefqtiyskffpead
    pkayaqhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtiskne
    vleivtaifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlanke
    ilrliqfepqkvkeklkekkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m2pA (A:)
    galskeileelqlntkfteeelsswyqsflkedpsgritrqefqtiyskffpeadpkaya
    qhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleiv
    taifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrli
    qfepqkvkeklk