PDB entry 4m24

View 4m24 on RCSB PDB site
Description: Crystal structure of the endo-1,4-glucanase, RBcel1, in complex with cellobiose
Class: hydrolase
Keywords: glycosyl hydrolase family 5, cellulase, tim barrel, beta-1,4-endoglucanase, hydrolase
Deposited on 2013-08-05, released 2014-12-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-31, with a file datestamp of 2014-12-26.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.126
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m24a_
  • Heterogens: TRS, CBI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m24A (A:)
    svdliginvagaeftggklpgkhgthyffppegyfeywseqgihtvrfplkwerlqpsln
    aelddvyaslvddmldqakendikvildvhnyaryrkkvigtedvpvsayqdlmeriakr
    wqghdalfaydimnepygsadklwpaaaqagidgvrkydkkrplliegaswssaarwpry
    adellklkdpadnmvfsahvyidedasgsykkgpgkdfepmigvkrvepfvnwlkehgkk
    ghigefgipndderwldamdkllaylnencipinywaagpswgnyklsiepkdgekrpqv
    allkkyaakdncsdfgpakae