PDB entry 4m1p

View 4m1p on RCSB PDB site
Description: Crystal structure of the copper-sensing repressor CsoR with Cu(I) from Geobacillus thermodenitrificans NG80-2
Deposited on 2013-08-03, released 2014-05-21
The last revision was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.217
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-sensitive operon repressor (CsoR)
    Species: Geobacillus thermodenitrificans [TaxId:420246]
    Gene: GTNG_1533
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CU1, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4m1pA (A:)
    ahpsqeehvlhgtmiprtkeeienimkrlkriegqvrgvqkmvednrycidilvqisaiq
    aalrqvgmqllerhanhcvakairegsgeqslrelmdvikqfak
    

    Sequence, based on observed residues (ATOM records):
    >4m1pA (A:)
    vlhgtmiprtkeeienimkrlkriegqvrgvqkmvednrycidilvqisaiqaalrqvgm
    qllerhanhcvakairegsgeqslrelmdvikqfak