PDB entry 4m1g

View 4m1g on RCSB PDB site
Description: Structure of murine IgG2a A27D7-Fab in complex with vaccinia antigen A33R at the resolution of 1.6 Angstroms
Class: immune system
Keywords: igg domain, antibody-antigen complex, fv, ch1, igg2a, antigen-binding fragment (fab), a33r antigen, papain digest of the mab, eev membrane (outer membrane of vaccinia ev form), immune system
Deposited on 2013-08-02, released 2014-08-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: a33r
    Species: Vaccinia virus [TaxId:10245]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71TT1
      • engineered mutation (29)
      • engineered mutation (34)
      • engineered mutation (51)
  • Chain 'B':
    Compound: a33r
    Species: Vaccinia virus [TaxId:10245]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71TT1 (Start-96)
      • engineered mutation (29)
      • engineered mutation (34)
      • engineered mutation (51)
  • Chain 'H':
    Compound: Murine IgG2a A27D7 Heavy chain Fab domain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4M1G (0-219)
  • Chain 'L':
    Compound: Murine IgG2a A27D7 Light chain Fab domain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4M1G (0-End)
    Domains in SCOPe 2.07: d4m1gl1, d4m1gl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4m1gL (L:)
    elvltqspttmaaspgekititcsasssissnylhwyqqkpgfspklliyrtsnlasgvp
    arfsgsgsgtsysltigtmeaedvatyycqqgssipftfgsgtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m1gL (L:)
    elvltqspttmaaspgekititcsasssissnylhwyqqkpgfspklliyrtsnlasgvp
    arfsgsgsgtsysltigtmeaedvatyycqqgssipftfgsgtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrne