PDB entry 4m0l

View 4m0l on RCSB PDB site
Description: Gamma subunit of the translation initiation factor 2 from Sulfolobus solfataricus complexed with GDP
Class: translation
Keywords: aIF2, aIF2 gamma subunit, G-protein, translation, translation initiation, protein biosynthesis, RNA-binding, GTP-binding, nucleotide-binding
Deposited on 2013-08-01, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.236
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 subunit gamma
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Gene: eif2g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m0la1, d4m0la2, d4m0la3
  • Chain 'B':
    Compound: Translation initiation factor 2 subunit gamma
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Gene: eif2g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m0lb1, d4m0lb2, d4m0lb3
  • Chain 'C':
    Compound: Translation initiation factor 2 subunit gamma
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Gene: eif2g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m0lc1, d4m0lc2, d4m0lc3
  • Chain 'D':
    Compound: Translation initiation factor 2 subunit gamma
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Gene: eif2g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m0ld1, d4m0ld2, d4m0ld3
  • Chain 'E':
    Compound: Translation initiation factor 2 subunit gamma
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Gene: eif2g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m0le1, d4m0le2, d4m0le3
  • Chain 'F':
    Compound: Translation initiation factor 2 subunit gamma
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Gene: eif2g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m0lf1, d4m0lf2, d4m0lf3
  • Heterogens: GDP, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m0lA (A:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m0lA (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkmtiklgyaetnigvcesck
    kpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanep
    fpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipv
    salhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggsii
    qglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyldp
    sltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvgs
    sttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m0lB (B:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m0lB (B:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtmtiklgyaetnigvcesckkpeayvte
    psckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtre
    hfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkini
    dsliegieeyiktpyrdlsqkpvmlvirsfdvnkkggviggsiiqglfkvdqeikvlpgl
    rvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitla
    daevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeie
    velrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4m0lC (C:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m0lC (C:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhtiklgyaetnigvcesckkpeayv
    tepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqt
    rehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhki
    nidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkv
    dqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyldpsltkad
    nllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgi
    vtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4m0lD (D:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m0lD (D:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtsktiklgyaetnigvcesckkpeayvt
    epsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtr
    ehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkin
    idsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvd
    qeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadn
    llgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgiv
    tsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4m0lE (E:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m0lE (E:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtsktiklgyaetnigvcesckkpeayvt
    epsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtr
    ehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkin
    idsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvd
    qeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadn
    llgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgiv
    tsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4m0lF (F:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m0lF (F:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei