PDB entry 4m0i

View 4m0i on RCSB PDB site
Description: crystal structure of synthetic hiv-1 capsid c-terminal domain (ctd) c198s mutant
Deposited on 2013-08-01, released 2014-12-17
The last revision was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.239
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 capsid protein
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71B91
      • engineered mutation (52)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4m0iA (A:)
sptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdsktilkal
gpgatleemmtacqgvggpghkarvl

    Sequence, based on observed residues (ATOM records):
    >4m0iA (A:)
sildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdsktilkalgpg
atleemmtacq