PDB entry 4lzl

View 4lzl on RCSB PDB site
Description: Structure of the inactive form of the regulatory domain from the repressor of iron transport regulator (RitR)
Class: Transcription
Keywords: Two-component response regulator, Transcription
Deposited on 2013-07-31, released 2014-09-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.143
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Streptococcus pneumoniae 2061617 [TaxId:914130]
    Gene: AMCSP02_000425, RitR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lzla_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4lzlA (A:)
mgkrilllekernlahflslelqkeqyrvdlveegqkalsmalqtdydlillnvnlgdmm
aqdfaeklsrtkpasvimildhwedlqeelevvqrfavsyiykpvlienlvarisaifrg
rdfi

    Sequence, based on observed residues (ATOM records): (download) 
    >4lzlA (A:)
gkrilllekernlahflslelqkeqyrvdlveegqkalsmalqtdydlillnvnlgdmma
qdfaeklsrtkpasvimildhwedlqeelevvqrfavsyiykpvlienlvarisaifrgr
dfi