PDB entry 4lz2
View 4lz2 on RCSB PDB site
Description: Crystal structure of the bromodomain of human BAZ2A
Class: signaling protein
Keywords: Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on
2013-07-31, released
2013-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated
2015-04-22, with a file datestamp of
2015-04-17.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bromodomain adjacent to zinc finger domain protein 2A
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2A, KIAA0314, TIP5
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4lz2a_ - Heterogens: EDO, MG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4lz2A (A:)
smhsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggyt
sseefaadallvfdncqtfneddsevgkaghimrrffesrweefyq
Sequence, based on observed residues (ATOM records): (download)
>4lz2A (A:)
ltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggytsseef
aadallvfdncqtfneddsevgkaghimrrffesrweefy