PDB entry 4lyw

View 4lyw on RCSB PDB site
Description: Crystal Structure of BRD4(1) bound to inhibitor XD14
Class: protein binding/inhibitor
Keywords: BRD4 inhibitor, bromodomain, epigenetic reader protein, acetylated lysine, histone tail, PROTEIN BINDING-INHIBITOR complex
Deposited on 2013-07-31, released 2014-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.199
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain-containing protein 4
  Species: Homo sapiens [TaxId:9606]
  Gene: BRD4, HUNK1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O60885 (2-126)
    • expression tag (0-1)
  Domains in SCOPe 2.07: d4lywa1, d4lywa2
• Heterogens: 21Q, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lywA (A:)
  amnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykii
  ktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqki
  nelptee