PDB entry 4lyl

View 4lyl on RCSB PDB site
Description: Crystal structure of uracil-DNA glycosylase from cod (Gadus morhua) in complex with the proteinaceous inhibitor UGI
Class: hydrolase/hydrolase inhibitor
Keywords: alpha/beta fold, hydrolysis, intracellular, hydrolase-hydrolase inhibitor complex
Deposited on 2013-07-31, released 2014-08-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.239
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Gadus morhua [TaxId:8049]
    Gene: ung1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I983 (3-222)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4lyla1, d4lyla2
  • Chain 'B':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Gene: UGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lylb_
  • Chain 'C':
    Compound: uracil-DNA glycosylase
    Species: Gadus morhua [TaxId:8049]
    Gene: ung1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I983 (3-222)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4lylc1, d4lylc2
  • Chain 'D':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Gene: UGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lyld_
  • Chain 'E':
    Compound: uracil-DNA glycosylase
    Species: Gadus morhua [TaxId:8049]
    Gene: ung1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I983 (3-222)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4lyle1, d4lyle2
  • Chain 'F':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Gene: UGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lylf_
  • Chain 'G':
    Compound: uracil-DNA glycosylase
    Species: Gadus morhua [TaxId:8049]
    Gene: ung1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I983 (3-222)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4lylg1, d4lylg2
  • Chain 'H':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Gene: UGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lylh_
  • Chain 'I':
    Compound: uracil-DNA glycosylase
    Species: Gadus morhua [TaxId:8049]
    Gene: ung1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I983 (3-222)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4lyli1, d4lyli2
  • Chain 'J':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Gene: UGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lylj_
  • Chain 'K':
    Compound: uracil-DNA glycosylase
    Species: Gadus morhua [TaxId:8049]
    Gene: ung1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I983 (3-222)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4lylk1, d4lylk2
  • Chain 'L':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Gene: UGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lyll_
  • Chain 'M':
    Compound: uracil-DNA glycosylase
    Species: Gadus morhua [TaxId:8049]
    Gene: ung1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I983 (3-222)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4lylm1, d4lylm2
  • Chain 'N':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Gene: UGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lyln_
  • Chain 'O':
    Compound: uracil-DNA glycosylase
    Species: Gadus morhua [TaxId:8049]
    Gene: ung1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I983 (3-222)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4lylo1, d4lylo2
  • Chain 'P':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Gene: UGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lylp_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lylA (A:)
    meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi
    lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl
    llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh
    hvlqavhpsplsahrgflgckhfskangllklsgtepinwral
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lylB (B:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lylB (B:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lylC (C:)
    meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi
    lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl
    llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh
    hvlqavhpsplsahrgflgckhfskangllklsgtepinwral
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lylD (D:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lylD (D:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lylE (E:)
    meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi
    lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl
    llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh
    hvlqavhpsplsahrgflgckhfskangllklsgtepinwral
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4lylF (F:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lylF (F:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lylG (G:)
    meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi
    lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl
    llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh
    hvlqavhpsplsahrgflgckhfskangllklsgtepinwral
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4lylH (H:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lylH (H:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lylI (I:)
    meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi
    lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl
    llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh
    hvlqavhpsplsahrgflgckhfskangllklsgtepinwral
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4lylJ (J:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lylJ (J:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lylK (K:)
    meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi
    lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl
    llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh
    hvlqavhpsplsahrgflgckhfskangllklsgtepinwral
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4lylL (L:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lylL (L:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lylM (M:)
    meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi
    lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl
    llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh
    hvlqavhpsplsahrgflgckhfskangllklsgtepinwral
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4lylN (N:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lylN (N:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lylO (O:)
    meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi
    lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl
    llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh
    hvlqavhpsplsahrgflgckhfskangllklsgtepinwral
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4lylP (P:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lylP (P:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml