PDB entry 4lx8

View 4lx8 on RCSB PDB site
Description: Crystal structure (2.2A) of Mg2+ bound CheY3 of Vibrio cholerae
Class: signaling protein
Keywords: signaling protein, Rossmann Fold, Response regulator, Magnesium binding, Signal transduction
Deposited on 2013-07-29, released 2013-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Vibrio cholerae [TaxId:345073]
  Gene: cheY-3, VC0395_A1653, VC395_2180
  Database cross-references and differences (RAF-indexed):
  • Uniprot A5F6J9 (1-123)
    • expression tag (0)
  Domains in SCOPe 2.08: d4lx8a1, d4lx8a2
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lx8A (A:)
  anknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmp
  gmqgidllkniradeelkhlpvlmitaeakreqiieaaqagvngyivkpftaatlkekld
  kife