PDB entry 4lwv

View 4lwv on RCSB PDB site
Description: The 2.3A Crystal Structure of Humanized Xenopus MDM2 with RO5545353
Class: Ligase/Ligase inhibitor
Keywords: MDM2, E3 Ubiquitin Ligase, p53, Nucleus, Ligase-Ligase inhibitor complex
Deposited on 2013-07-28, released 2014-07-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.233
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: E3 ubiquitin-protein ligase Mdm2
  Species: Xenopus laevis [TaxId:8355]
  Gene: MDM2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56273 (0-84)
    • engineered mutation (29)
    • engineered mutation (71)
    • engineered mutation (74)
  Domains in SCOPe 2.08: d4lwva_
• Chain 'B':
  Compound: E3 ubiquitin-protein ligase Mdm2
  Species: Xenopus laevis [TaxId:8355]
  Gene: MDM2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56273 (0-84)
    • engineered mutation (29)
    • engineered mutation (71)
    • engineered mutation (74)
  Domains in SCOPe 2.08: d4lwvb_
• Chain 'C':
  Compound: E3 ubiquitin-protein ligase Mdm2
  Species: Xenopus laevis [TaxId:8355]
  Gene: MDM2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56273 (0-84)
    • engineered mutation (29)
    • engineered mutation (71)
    • engineered mutation (74)
  Domains in SCOPe 2.08: d4lwvc_
• Heterogens: 20W, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lwvA (A:)
  eklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplge
  lfgvqefsvkehrriyamisrnlvs
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lwvB (B:)
  eklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplge
  lfgvqefsvkehrriyamisrnlvs
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lwvC (C:)
  eklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplge
  lfgvqefsvkehrriyamisrnlvs