PDB entry 4lwt

View 4lwt on RCSB PDB site
Description: The 1.6A Crystal Structure of Humanized Xenopus MDM2 with RO5027344
Class: Ligase/Ligase Inhibitor
Keywords: MDM2, Indolinone, E3 Ubiquitin Ligase, p53, Nucleus, Ligase-Ligase Inhibitor complex
Deposited on 2013-07-28, released 2014-07-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.223
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Xenopus laevis [TaxId:8355]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56273 (1-85)
      • initiating methionine (0)
      • engineered mutation (30)
      • engineered mutation (72)
      • engineered mutation (75)
    Domains in SCOPe 2.06: d4lwta_
  • Heterogens: 20Q, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lwtA (A:)
meklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplg
elfgvqefsvkehrriyamisrnlvs