PDB entry 4lwr

View 4lwr on RCSB PDB site
Description: Crystal structure of the ternary complex of peptidyl tRNA hydrolase from Acinetobacter baumannii with cytosine arabinoside and phosphate ion at 1.1A resolution
Class: hydrolase
Keywords: Protein synthesis, HYDROLASE
Deposited on 2013-07-28, released 2013-08-14
Made obsolete by 5y9a on 2017-09-13

The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.154
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-tRNA hydrolase
  Species: Acinetobacter baumannii [TaxId:575584]
  Gene: PTH
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0C9L6 (3-195)
    • expression tag (0-2)
  Domains in SCOPe 2.06: d4lwra1, d4lwra2
• Heterogens: AR3, PO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lwrA (A:)
  gshmsnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieg
  hdvrlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghng
  lrdivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvq
  gqvpqamnqinaykpa