PDB entry 4lwr

View 4lwr on RCSB PDB site
Description: crystal structure of the ternary complex of peptidyl trna hydrolase from acinetobacter baumannii with cytosine arabinoside and phosphate ion at 1.1a resolution
Deposited on 2013-07-28, released 2013-08-14
Made obsolete by 5y9a on 2017-09-13

The last revision was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Acinetobacter baumannii [TaxId:575584]
    Gene: PTH
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0C9L6 (3-195)
      • expression tag (0-2)
  • Heterogens: AR3, PO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4lwrA (A:)
gshmsnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieg
hdvrlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghng
lrdivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvq
gqvpqamnqinaykpa