PDB entry 4lw4

View 4lw4 on RCSB PDB site
Description: Structural changes during cysteine desulfurase CsdA and sulfur-acceptor CsdE interactions provide insight into the trans-persulfuration
Class: lyase
Keywords: cysteine desulfurase, CsdA, SufE, LYASE
Deposited on 2013-07-26, released 2013-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.162
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine sulfinate desulfinase
    Species: Escherichia coli [TaxId:83333]
    Gene: b2810, csdA, JW2781, ygdJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lw4a_
  • Chain 'B':
    Compound: Cysteine sulfinate desulfinase
    Species: Escherichia coli [TaxId:83333]
    Gene: b2810, csdA, JW2781, ygdJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lw4b_
  • Chain 'C':
    Compound: Cysteine desulfuration protein CsdE
    Species: Escherichia coli [TaxId:714962]
    Gene: csdE, ECOK1_3187
    Database cross-references and differences (RAF-indexed):
    • Uniprot D5CZ88 (Start-149)
      • engineered mutation (51)
    Domains in SCOPe 2.07: d4lw4c_
  • Chain 'D':
    Compound: Cysteine desulfuration protein CsdE
    Species: Escherichia coli [TaxId:714962]
    Gene: csdE, ECOK1_3187
    Database cross-references and differences (RAF-indexed):
    • Uniprot D5CZ88
      • engineered mutation (51)
    Domains in SCOPe 2.07: d4lw4d_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lw4A (A:)
    gshmnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfae
    aqrltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsva
    ehhanlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcp
    dlaraitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkse
    lleamspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqa
    eswsrslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqh
    caqpllaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lw4A (A:)
    vfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagfaeaqrltaryeaa
    rekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehhanlvpwlm
    vaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdlaraitfahs
    agmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselleamspwlgg
    gkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaeswsrslatla
    edalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhcaqpllaelgv
    tgtlrasfapyntksdvdalvnavdralellv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lw4B (B:)
    gshmnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfae
    aqrltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsva
    ehhanlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcp
    dlaraitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkse
    lleamspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqa
    eswsrslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqh
    caqpllaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lw4B (B:)
    vfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqrlt
    aryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehhan
    lvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdlara
    itfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselleam
    spwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaeswsr
    slatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhcaqpl
    laelgvtgtlrasfapyntksdvdalvnavdralellv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lw4C (C:)
    gshmtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqake
    iagcenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfd
    elglraqlsasrsqglnalseaiiaaakqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lw4C (C:)
    npqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagce
    nrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglr
    aqlsasrsqglnalseaiiaaakqv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lw4D (D:)
    gshmtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqake
    iagcenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfd
    elglraqlsasrsqglnalseaiiaaakqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lw4D (D:)
    ghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagenrvwlg
    ytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsas
    rsqglnalseaiiaaak