PDB entry 4lvn

View 4lvn on RCSB PDB site
Description: Crystal structure of PfSUB1-prodomain-NIMP.M7 Fab complex
Class: hydrolase/inhibitor/immune system
Keywords: alpha beta, enzyme-prodomain complex, Rossmann fold, serine protease, calcium ions, prodomain, parasitophorous vacuole, hydrolase-inhibitor-immune system complex
Deposited on 2013-07-26, released 2014-05-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.198
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subtilisin-like serine protease
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: sub-1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: NIMP.M7 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LVN (0-211)
    Domains in SCOPe 2.05: d4lvnb1, d4lvnb2
  • Chain 'C':
    Compound: NIMP.M7 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LVN (0-219)
  • Chain 'P':
    Compound: subtilisin-like serine protease
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: sub-1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NI, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lvnB (B:)
    divltqspatmsaslgqrvsmscsasssvstsyfhwyqqkpgsspklwiystsnlasgvp
    grfsgsgsgtsyslsissmeaedaatyychqfhrspltfgagtklelkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lvnB (B:)
    divltqspatmsaslgqrvsmscsasssvstsyfhwyqqkpgsspklwiystsnlasgvp
    grfsgsgsgtsyslsissmeaedaatyychqfhrspltfgagtklelkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltrhnsytceathktstspivksfnr
    

  • Chain 'C':
    No sequence available.

  • Chain 'P':
    No sequence available.