PDB entry 4lvh

View 4lvh on RCSB PDB site
Description: Insight into highly conserved H1 subtype-specific epitopes in influenza virus hemagglutinin
Class: immune system
Keywords: influenza virus, Immune system, hemagglutinin, antibody
Deposited on 2013-07-26, released 2014-04-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.234
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:644289]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: monoclonal antibody h-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LVH (Start-221)
  • Chain 'C':
    Compound: monoclonal antibody l-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LVH (Start-210)
    Domains in SCOPe 2.03: d4lvhc1, d4lvhc2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:644289]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: monoclonal antibody h-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LVH (Start-221)
  • Chain 'F':
    Compound: monoclonal antibody l-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LVH (Start-210)
    Domains in SCOPe 2.03: d4lvhf1, d4lvhf2
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:644289]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: monoclonal antibody h-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LVH (Start-221)
  • Chain 'I':
    Compound: monoclonal antibody l-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LVH (Start-210)
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:644289]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: monoclonal antibody h-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LVH (Start-221)
  • Chain 'L':
    Compound: monoclonal antibody l-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LVH (Start-210)
    Domains in SCOPe 2.03: d4lvhl1, d4lvhl2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lvhC (C:)
    diqmtqspaslavspgqratitcrasesvsnyginfinwfqqkpgqppklliytasnkgt
    gvparfsgsgsgtdftltinpveaedtanyfcqqtkevpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkinvkwkidgserqngvlnswtdqdskdstysmss
    tltldeyerhnsytceathktstspivksfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lvhC (C:)
    iqmtqspaslavspgqratitcrasesvsnyginfinwfqqkpgqppklliytasnkgtg
    vparfsgsgsgtdftltinpveaedtanyfcqqtkevpytfgggtkleikradaaptvsi
    fppsseqltsggasvvcflnnfypkinvkwkidgserqngvlnswtdqdskdstysmsst
    ltldeyerhnsytceathktstspivksfn
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4lvhF (F:)
    diqmtqspaslavspgqratitcrasesvsnyginfinwfqqkpgqppklliytasnkgt
    gvparfsgsgsgtdftltinpveaedtanyfcqqtkevpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkinvkwkidgserqngvlnswtdqdskdstysmss
    tltldeyerhnsytceathktstspivksfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lvhF (F:)
    iqmtqspaslavspgqratitcrasesvsnyginfinwfqqkpgqppklliytasnkgtg
    vparfsgsgsgtdftltinpveaedtanyfcqqtkevpytfgggtkleikradaaptvsi
    fppsseqltsggasvvcflnnfypkinvkwkidgserqngvlnswtdqdskdstysmsst
    ltldeyerhnsytceathktstspivksfn
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4lvhL (L:)
    diqmtqspaslavspgqratitcrasesvsnyginfinwfqqkpgqppklliytasnkgt
    gvparfsgsgsgtdftltinpveaedtanyfcqqtkevpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkinvkwkidgserqngvlnswtdqdskdstysmss
    tltldeyerhnsytceathktstspivksfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lvhL (L:)
    iqmtqspaslavspgqratitcraesvsnyginfinwfqqkpgqppklliytasnkgtgv
    parfsgsgsgtdftltinpveaedtanyfcqqtkevpytfgggtkleikradaaptvsif
    ppsseqltsggasvvcflnnfypkinvkwkidgserqngvlnswtdqdskdstysmsstl
    tldeyerhnsytceathktstspivksfn