PDB entry 4lve

View 4lve on RCSB PDB site
Description: len k30t mutant: a domain flip as a result of a single amino acid substitution
Class: immunoglobulin
Keywords: immunoglobulin, kappa-IV, light chain dimer
Deposited on 1998-05-12, released 1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: len
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01625
      • engineered (35)
    Domains in SCOPe 2.08: d4lvea_
  • Chain 'B':
    Compound: len
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01625 (0-End)
      • engineered (35)
    Domains in SCOPe 2.08: d4lveb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lveA (A:)
divmtqspdslavslgeratinckssqsvlyssnstnylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4lveB (B:)
divmtqspdslavslgeratinckssqsvlyssnstnylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr

    Sequence, based on observed residues (ATOM records): (download) 
    >4lveB (B:)
divmtqspdslavslgeratinckssqsvlyssnstnylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleik