PDB entry 4lul

View 4lul on RCSB PDB site
Description: The crystal structure of the P132A, Y133D mutant of Pyrococcus furiosus phosphoglucose isomerase in complex with manganese.
Class: isomerase
Keywords: Cupin Fold, Isomerase, Glucose 6-phsphate and Fructose 6-phosphate binding protein
Deposited on 2013-07-25, released 2014-07-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: pgiA, PF0196
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83194 (0-188)
      • engineered mutation (131-132)
    Domains in SCOPe 2.08: d4lula_
  • Chain 'B':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: pgiA, PF0196
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83194 (0-188)
      • engineered mutation (131-132)
    Domains in SCOPe 2.08: d4lulb_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lulA (A:)
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvpadwahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprwkk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lulB (B:)
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvpadwahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprwkk