PDB entry 4lug

View 4lug on RCSB PDB site
Description: Crystal structure of Inorganic Pyrophosphatase PPA1 from Arabidopsis thaliana
Class: hydrolase
Keywords: Hydrolysis of pyrophosphate, Magnesium ion binding, Metal binding, HYDROLASE
Deposited on 2013-07-25, released 2014-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.157
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PPA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4luga_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PPA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lugb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lugA (A:)
    ahpwhdleigpgapqifnvvveitkgskvkyeldkktglikvdrilyssvvyphnygfvp
    rtlcedndpidvlvimqepvlpgcflraraiglmpmidqgekddkiiavcvddpeykhyt
    dikelpphrlseirrffedykknenkevavndflpsesaveaiqysmdlyaeyilhtlrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lugA (A:)
    ahpwhdleigpgapqifnvvveitkgskvkyeldkktglikvdrilyssvvyphnygfvp
    rtlcedndpidvlvimqepvlpgcflraraiglmpmidqgekddkiiavcvddpeykhyt
    dikelpphrlseirrffedykknenkevavndflpsesaveaiqysmdlyaeyil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lugB (B:)
    ahpwhdleigpgapqifnvvveitkgskvkyeldkktglikvdrilyssvvyphnygfvp
    rtlcedndpidvlvimqepvlpgcflraraiglmpmidqgekddkiiavcvddpeykhyt
    dikelpphrlseirrffedykknenkevavndflpsesaveaiqysmdlyaeyilhtlrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lugB (B:)
    ahpwhdleigpgapqifnvvveitkgskvkyeldkktglikvdrilyssvvyphnygfvp
    rtlcedndpidvlvimqepvlpgcflraraiglmpmidqgekddkiiavcvddpeykhyt
    dikelpphrlseirrffedykknenkevavndflpsesaveaiqysmdlyaeyilh