PDB entry 4lu8

View 4lu8 on RCSB PDB site
Description: Crystal structure of pyrococcus horikoshii cutA1 complexed with CO2+
Class: metal binding protein
Keywords: cuta, trimer, divalent cation tolerance, structural genomics, riken structural genomics/proteomics initiative, rsgi, metal binding protein
Deposited on 2013-07-24, released 2013-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.08: d4lu8a_
• Chain 'B':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.08: d4lu8b_
• Chain 'C':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.08: d4lu8c_
• Chain 'D':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.08: d4lu8d_
• Chain 'E':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.08: d4lu8e_
• Chain 'F':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.08: d4lu8f_
• Heterogens: CO, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lu8A (A:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lu8B (B:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lu8C (C:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lu8D (D:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lu8E (E:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lu8F (F:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk