PDB entry 4lu3

View 4lu3 on RCSB PDB site
Description: The crystal structure of the human carbonic anhydrase XIV
Class: Lyase/lyase Inhibitor
Keywords: ZINC BINDING, GLYCOPROTEIN, MEMBRANE, Lyase-lyase Inhibitor complex
Deposited on 2013-07-24, released 2014-01-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: CA14, UNQ690/PRO1335
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lu3a_
  • Heterogens: ZN, AZM, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lu3A (A:)
    adggqhwtyegphgqdhwpasypecgnnaqspidiqtdsvtfdpdlpalqphgydqpgte
    pldlhnnghtvqlslpstlylgglprkyvaaqlhlhwgqkgspggsehqinseatfaelh
    ivhydsdsydslseaaerpqglavlgilievgetkniayehilshlhevrhkdqktsvpp
    fnlrellpkqlgqyfryngslttppcyqsvlwtvfyrrsqismeqleklqgtlfsteeep
    skllvqnyralqplnqrmvfasfiqagssyttgemlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lu3A (A:)
    hwtyegphgqdhwpasypecgnnaqspidiqtdsvtfdpdlpalqphgydqpgtepldlh
    nnghtvqlslpstlylgglprkyvaaqlhlhwgqkgspggsehqinseatfaelhivhyd
    sdsydslseaaerpqglavlgilievgetkniayehilshlhevrhkdqktsvppfnlre
    llpkqlgqyfryngslttppcyqsvlwtvfyrrsqismeqleklqgtlfsteeepskllv
    qnyralqplnqrmvfasfiqagssyt