PDB entry 4lu1

View 4lu1 on RCSB PDB site
Description: Crystal structure of the uncharacterized Maf protein YceF from E. coli, mutant D69A
Class: hydrolase
Keywords: Maf protein, putative pyrophosphatase, Structural Genomics, Structural Genomics Consortium, SGC, HYDROLASE
Deposited on 2013-07-24, released 2013-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maf-like protein YceF
    Species: Escherichia coli [TaxId:83333]
    Gene: yceF
    Database cross-references and differences (RAF-indexed):
    • Uniprot C9QYM5
      • engineered mutation (89)
    Domains in SCOPe 2.07: d4lu1a_
  • Chain 'B':
    Compound: Maf-like protein YceF
    Species: Escherichia coli [TaxId:83333]
    Gene: yceF
    Database cross-references and differences (RAF-indexed):
    • Uniprot C9QYM5
      • engineered mutation (89)
    Domains in SCOPe 2.07: d4lu1b_
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lu1A (A:)
    mgsshhhhhhssgrenlyfqgmpklilastspwrralleklqisfecaapevdetprsde
    sprqlvlrlaqekaqslasrypdhliigsaqvcvldgeitgkplteenarlqlrkasgni
    vtfytglalfnsanghlqtevepfdvhfrhlseaeidnyvrkehplhcagsfksegfgit
    lferlegrdpntlvglplialcqmlrregknplmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lu1A (A:)
    klilastspwrralleklqisfecaapevdetprsdesprqlvlrlaqekaqslasrypd
    hliigsaqvcvldgeitgkplteenarlqlrkasgnivtfytglalfnsanghlqtevep
    fdvhfrhlseaeidnyvrkehplhcagsfksegfgitlferlegrdpntlvglplialcq
    mlrregknplm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lu1B (B:)
    mgsshhhhhhssgrenlyfqgmpklilastspwrralleklqisfecaapevdetprsde
    sprqlvlrlaqekaqslasrypdhliigsaqvcvldgeitgkplteenarlqlrkasgni
    vtfytglalfnsanghlqtevepfdvhfrhlseaeidnyvrkehplhcagsfksegfgit
    lferlegrdpntlvglplialcqmlrregknplmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lu1B (B:)
    klilastspwrralleklqisfecaapevdetprsdesprqlvlrlaqekaqslasrypd
    hliigsaqvcvldgeitteenarlqlrkasgnivtfytglalfnsanghlqtevepfdvh
    frhlseaeidnyvrkfksegfgitlferlegrdpntlvglplialcqmlrregknplm