PDB entry 4ltu

View 4ltu on RCSB PDB site
Description: Crystal Structure of Ferredoxin from Rhodopseudomonas palustris HaA2
Class: electron transport
Keywords: 2Fe-2S single cluster domain, ELECTRON TRANSPORT
Deposited on 2013-07-24, released 2014-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.232
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3614
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2IU01 (Start-106)
      • conflict (101)
    Domains in SCOPe 2.07: d4ltua_
  • Chain 'B':
    Compound: ferredoxin
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3614
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2IU01 (Start-106)
      • conflict (101)
    Domains in SCOPe 2.07: d4ltub_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ltuA (A:)
    mpsitfihpdgrseivdaaigdsamfaalnhgidsivaecggnavcatchvyvddlwlak
    lppvdaneddlldgtasdrlpnsrlscqikiapeldglvlriperqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ltuA (A:)
    psitfihpdgrseivdaaigdsamfaalnhgidsivaecggnavcatchvyvddlwlakl
    ppvdaneddlldgtasdrlpnsrlscqikiapeldglvlriperqt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ltuB (B:)
    mpsitfihpdgrseivdaaigdsamfaalnhgidsivaecggnavcatchvyvddlwlak
    lppvdaneddlldgtasdrlpnsrlscqikiapeldglvlriperqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ltuB (B:)
    psitfihpdgrseivdaaigdsamfaalnhgidsivaecggnavcatchvyvddlwlakl
    ppvdaneddlldgtasdrlpnsrlscqikiapeldglvlriperqt