PDB entry 4ltt

View 4ltt on RCSB PDB site
Description: Crystal structure of native apo toxin from Helicobacter pylori
Class: toxin
Keywords: Toxin-antitoxin, Toxin
Deposited on 2013-07-23, released 2014-02-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.181
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein, Toxin
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: C694_04590, HP_0894
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25554 (0-87)
      • expression tag (88-90)
    Domains in SCOPe 2.08: d4ltta1, d4ltta2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4lttA (A:)
mlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfrech
ikpdvllvylvkddelillrlgshselflegss

    Sequence, based on observed residues (ATOM records): (download) 
    >4lttA (A:)
mlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfrech
ikpdvllvylvkddelillrlgshselfleg