PDB entry 4lta

View 4lta on RCSB PDB site
Description: The crystal structure of the P132R, Y133G mutant of Pyrococcus furiosus phosphoglucose isomerase in complex with manganese and 5-phospho-D-arabinonate.
Class: isomerase
Keywords: Cupin Fold, Isomerase, Glucose 6-phosphate and Fructose 6-phosphate binding
Deposited on 2013-07-23, released 2014-07-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: pgiA, PF0196
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83194 (0-188)
      • engineered mutation (131-132)
    Domains in SCOPe 2.08: d4ltaa_
  • Chain 'B':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: pgiA, PF0196
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83194 (0-188)
      • engineered mutation (131-132)
    Domains in SCOPe 2.08: d4ltab_
  • Heterogens: MN, PA5, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ltaA (A:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvprgwahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprwkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ltaB (B:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvprgwahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprwkk