PDB entry 4lt7

View 4lt7 on RCSB PDB site
Description: Crystal structure of the c2a domain of rabphilin-3a in complex with a calcium
Class: protein transport
Keywords: calcium binding, C2 domain, signal transduction, protein transport
Deposited on 2013-07-23, released 2013-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rabphilin-3a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rph3a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lt7a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lt7A (A:)
    dqattlgalefsllydqdnsnlqctiirakglkpmdsngladpyvklhllpgasksnklr
    tktlrntrnpvwnetlqyhgiteedmqrktlrisvcdedkfghnefigetrfslkklkan
    qrknfniclervi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lt7A (A:)
    tlgalefsllydqdnsnlqctiirakglkpmdsngladpyvklhllpgasksnklrtktl
    rntrnpvwnetlqyhgiteedmqrktlrisvcdedkfghnefigetrfslkklkanqrkn
    fniclerv