PDB entry 4lss

View 4lss on RCSB PDB site
Description: Crystal structure of broadly and potently neutralizing antibody VRC01 in complex with HIV-1 clade A strain KER_2018_11 gp120
Class: viral protein/immune system
Keywords: antibody antigen complex, Neutralizing antibody VRC01, viral protein-immune system complex
Deposited on 2013-07-23, released 2013-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: envelope glycoprotein gp120
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • PDB 4LSS (0-358)
  • Chain 'H':
    Compound: heavy chain of antibody vrc01
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LSS (0-223)
  • Chain 'L':
    Compound: LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LSS (Start-209)
    Domains in SCOPe 2.08: d4lssl1, d4lssl2
  • Heterogens: NAG, EPE, IPA, NA, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >4lssL (L:)
eivltqspgtlslspgetaiiscrtsqygslawyqqrpgqaprlviysgstraagipdrf
sgsrwgpdytltisnlesgdfgvyycqqyeffgqgtkvqvdikrtvaapsvfifppsdeq
lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
dyekhkvyacevthqglrspvtksfnrgec

    Sequence, based on observed residues (ATOM records): (download) 
    >4lssL (L:)
vltqspgtlslspgetaiiscrtsqygslawyqqrpgqaprlviysgstraagipdrfsg
srwgpdytltisnlesgdfgvyycqqyeffgqgtkvqvdikrtvaapsvfifppsdeqlk
sgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskady
ekhkvyacevthqglrspvtksfnrgec