PDB entry 4ls4

View 4ls4 on RCSB PDB site
Description: Crystal structure of L66S mutant toxin from Helicobacter pylori
Class: Toxin
Keywords: Toxin-antitoxin system, Toxin
Deposited on 2013-07-22, released 2014-02-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.175
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Uncharacterized protein, Toxin
  Species: HELICOBACTER PYLORI [TaxId:85962]
  Gene: C694_04590, HP_0894
  Database cross-references and differences (RAF-indexed):
  • Uniprot O25554 (3-90)
    • expression tag (1-2)
    • engineered mutation (68)
  Domains in SCOPe 2.03: d4ls4a_
• Chain 'B':
  Compound: Uncharacterized protein, Toxin
  Species: HELICOBACTER PYLORI [TaxId:85962]
  Gene: C694_04590, HP_0894
  Database cross-references and differences (RAF-indexed):
  • Uniprot O25554 (3-90)
    • expression tag (1-2)
    • engineered mutation (68)
• Heterogens: BR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4ls4A (A:)
  gshmlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfr
  echikpdvslvylvkddelillrlgshself
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4ls4A (A:)
  shmlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfre
  chikpdvslvylvkddelillrlgshself
  

  
  
• Chain 'B':
  No sequence available.