PDB entry 4lrz

View 4lrz on RCSB PDB site
Description: Crystal Structure of the E.coli DhaR(N)-DhaL complex
Class: Transferase/Transcription Regulator
Keywords: coiled-coil, helix rotation, GAF, PAS, transcriptional regulation complex, Transferase-Transcription Regulator complex
Deposited on 2013-07-21, released 2014-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PTS-dependent dihydroxyacetone kinase, ADP-binding subunit dhaL
    Species: Escherichia coli [TaxId:83333]
    Gene: b1199, dhaL, dhaR, JW5186, ycgS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76014 (2-210)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d4lrza1, d4lrza2
  • Chain 'B':
    Compound: PTS-dependent dihydroxyacetone kinase, ADP-binding subunit dhaL
    Species: Escherichia coli [TaxId:83333]
    Gene: b1199, dhaL, dhaR, JW5186, ycgS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76014 (2-210)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d4lrzb1, d4lrzb2
  • Chain 'C':
    Compound: PTS-dependent dihydroxyacetone kinase, ADP-binding subunit dhaL
    Species: Escherichia coli [TaxId:83333]
    Gene: b1199, dhaL, dhaR, JW5186, ycgS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76014 (2-210)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d4lrzc1, d4lrzc2
  • Chain 'D':
    Compound: PTS-dependent dihydroxyacetone kinase, ADP-binding subunit dhaL
    Species: Escherichia coli [TaxId:83333]
    Gene: b1199, dhaL, dhaR, JW5186, ycgS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76014 (2-210)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d4lrzd1, d4lrzd2
  • Chain 'E':
    Compound: PTS-dependent dihydroxyacetone kinase operon regulatory protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b1201, dhaL, dhaR, JW5188, ycgU
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: PTS-dependent dihydroxyacetone kinase operon regulatory protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b1201, dhaL, dhaR, JW5188, ycgU
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: PTS-dependent dihydroxyacetone kinase operon regulatory protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b1201, dhaL, dhaR, JW5188, ycgU
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: PTS-dependent dihydroxyacetone kinase operon regulatory protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b1201, dhaL, dhaR, JW5188, ycgU
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lrzA (A:)
gsslsrtqivnwltrcgdifsteseyltgldreigdadhglnmnrgfskvveklpaiadk
digfilkntgmtllssvggasgplfgtffiraaqatqarqsltleelyqmfrdgadgvis
rgkaepgdktmcdvwvpvveslrqsseqnlsvpvaleaassiaesaaqstitmqarkgra
sylgersighqdpgatsvmfmmqmlalaake

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lrzB (B:)
gsslsrtqivnwltrcgdifsteseyltgldreigdadhglnmnrgfskvveklpaiadk
digfilkntgmtllssvggasgplfgtffiraaqatqarqsltleelyqmfrdgadgvis
rgkaepgdktmcdvwvpvveslrqsseqnlsvpvaleaassiaesaaqstitmqarkgra
sylgersighqdpgatsvmfmmqmlalaake

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lrzC (C:)
gsslsrtqivnwltrcgdifsteseyltgldreigdadhglnmnrgfskvveklpaiadk
digfilkntgmtllssvggasgplfgtffiraaqatqarqsltleelyqmfrdgadgvis
rgkaepgdktmcdvwvpvveslrqsseqnlsvpvaleaassiaesaaqstitmqarkgra
sylgersighqdpgatsvmfmmqmlalaake

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lrzD (D:)
gsslsrtqivnwltrcgdifsteseyltgldreigdadhglnmnrgfskvveklpaiadk
digfilkntgmtllssvggasgplfgtffiraaqatqarqsltleelyqmfrdgadgvis
rgkaepgdktmcdvwvpvveslrqsseqnlsvpvaleaassiaesaaqstitmqarkgra
sylgersighqdpgatsvmfmmqmlalaake

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.