PDB entry 4lru

View 4lru on RCSB PDB site
Description: Crystal structure of glyoxalase III (Orf 19.251) from Candida albicans
Class: lyase
Keywords: DJ-1 superfamily, LYASE
Deposited on 2013-07-20, released 2013-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.159
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glyoxalase III (glutathione-independent)
    Species: Candida albicans [TaxId:237561]
    Gene: CaO19.7882, Orf 19.251, orf19.7882
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5AF03 (3-238)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4lrua1, d4lrua2
  • Heterogens: EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lruA (A:)
    gshmvkvllaltsynetfysdgkktgvfvvealhpfevfrkkgyeiqlasetgtfgwddh
    svvpdflngedkeifdnvnsefnvalknlkkasdldpndydiffgsaghgtlfdypnakd
    lqkiattvydkggvvsavchgpaifenlndpktgeplikgkkitgftdigedilgvtdim
    kkgnlltikqvaekegatyiepegpwdnftvtdgrivtgvnpqsavktaedviaafecn